GSK3B

GSK3B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1GNG, 1H8F, 1I09, 1J1B, 1J1C, 1O6K, 1O6L, 1O9U, 1PYX, 1Q3D, 1Q3W, 1Q41, 1Q4L, 1Q5K, 1R0E, 1UV5, 2JDO, 2JDR, 2JLD, 2O5K, 2OW3, 2UW9, 2X39, 2XH5, 3CQU, 3CQW, 3DU8, 3E87, 3E88, 3E8D, 3F7Z, 3F88, 3GB2, 3I4B, 3L1S, 3M1S, 3MV5, 3OW4, 3PUP, 3Q3B, 3QKK, 3SAY, 3SD0, 3ZDI, 3ZRK, 3ZRL, 3ZRM, 4ACC, 4ACD, 4ACG, 4ACH, 4AFJ, 4B7T, 4DIT, 4EKK, 4IQ6, 4J1R, 4J71, 4NM0, 4NM3, 4NM5, 4NM7, 4PTC, 4PTE, 4PTG, 5F94, 5F95, 5HLP, 5HLN

Ідентифікатори
Символи GSK3B, Gsk3b, 7330414F15Rik, 8430431H08Rik, C86142, GSK-3, GSK-3beta, GSK3, glycogen synthase kinase 3 beta
Зовнішні ІД OMIM: 605004 MGI: 1861437 HomoloGene: 55629 GeneCards: GSK3B
шифр КФ 2.7.11.1
Реагує на сполуку
тайдглусіб, тайдглусіб, Цитрат літію, ly-2090314[1]
Онтологія гена
Молекулярна функція

• kinase activity
• ATP binding
• protein kinase activity
• protein kinase A catalytic subunit binding
• protein serine/threonine kinase activity
• transferase activity
• NF-kappaB binding
• tau-protein kinase activity
• GO:0001948, GO:0016582 protein binding
• nucleotide binding
• p53 binding
• ubiquitin protein ligase binding
• protease binding
• beta-catenin binding
• protein kinase binding
• dynactin binding
• tau protein binding

Клітинна компонента

• цитоплазма
• мембрана
• мітохондрія
• клітинне ядро
• центросома
• клітинна мембрана
• гіалоплазма
• beta-catenin destruction complex
• postsynapse
• Wnt signalosome
• нуклеоплазма
• аксон
• дендрит (нейробіологія)
• glutamatergic synapse

Біологічний процес

• ритмічний процес
• negative regulation of type B pancreatic cell development
• negative regulation of protein binding
• negative regulation of glycogen (starch) synthase activity
• glycogen metabolic process
• superior temporal gyrus development
• negative regulation of canonical Wnt signaling pathway
• chemical synaptic transmission, postsynaptic
• GO:0106160 negative regulation of protein-containing complex assembly
• positive regulation of protein export from nucleus
• GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
• protein autophosphorylation
• диференціація клітин
• negative regulation of protein localization to nucleus
• фосфорилювання
• positive regulation of cell-matrix adhesion
• нейробіологія розвитку
• dopamine receptor signaling pathway
• Епітеліально-мезенхімальний перехід
• peptidyl-threonine phosphorylation
• positive regulation of protein-containing complex assembly
• positive regulation of neuron death
• negative regulation of glycogen biosynthetic process
• multicellular organism development
• regulation of cellular response to heat
• negative regulation of signal transduction
• hippocampus development
• beta-catenin destruction complex disassembly
• proteasome-mediated ubiquitin-dependent protein catabolic process
• Wnt signaling pathway
• beta-catenin destruction complex assembly
• protein phosphorylation
• positive regulation of mitochondrion organization
• GO:0007243 intracellular signal transduction
• GO:1903364 positive regulation of protein catabolic process
• negative regulation of dopaminergic neuron differentiation
• ER overload response
• циркадний ритм
• GO:0035404 peptidyl-serine phosphorylation
• positive regulation of protein binding
• positive regulation of proteasomal ubiquitin-dependent protein catabolic process
• regulation of microtubule-based process
• cellular response to interleukin-3
• negative regulation of apoptotic process
• canonical Wnt signaling pathway
• extrinsic apoptotic signaling pathway in absence of ligand
• positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
• carbohydrate metabolic process
• neuron projection development
• negative regulation of neuron death
• GO:1901313 positive regulation of gene expression
• establishment of cell polarity
• maintenance of cell polarity
• regulation of axon extension
• negative regulation of phosphoprotein phosphatase activity
• regulation of dendrite morphogenesis
• regulation of axonogenesis
• excitatory postsynaptic potential
• regulation of microtubule cytoskeleton organization
• negative regulation of calcineurin-NFAT signaling cascade
• extrinsic apoptotic signaling pathway
• neuron projection retraction
• negative regulation of protein acetylation
• cellular response to amyloid-beta
• positive regulation of protein localization to centrosome
• regulation of synaptic vesicle exocytosis
• neuron projection organization
• positive regulation of autophagy
• regulation of circadian rhythm
• regulation of long-term synaptic potentiation
• regulation of microtubule anchoring at centrosome

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
2932
56637
Ensembl
ENSG00000082701
ENSMUSG00000022812
UniProt
P49841
Q9WV60
RefSeq (мРНК)
NM_001146156
NM_002093
NM_001354596
NM_019827
NM_001347232
RefSeq (білок)
NP_001139628
NP_002084
NP_001341525
NP_001334161
NP_062801
Локус (UCSC) Хр. 3: 119.82 – 120.09 Mb Хр. 16: 37.91 – 38.07 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GSK3B (англ. Glycogen synthase kinase 3 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 420 амінокислот, а молекулярна маса — 46 744[5].

Послідовність амінокислот
1020304050
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDR
PQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
MRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAK
QTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCD
FGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAEL
LLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, білків розвитку, фосфопротеїнів, інгібіторів трансдукції сигналу. Задіяний у таких біологічних процесах як біологічні ритми, вуглеводний обмін, метаболізм глікогену, диференціація, нейрогенез, сигнальний шлях Wnt, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література

  • Stambolic V., Woodgett J.R. (1994). Mitogen inactivation of glycogen synthase kinase-3 beta in intact cells via serine 9 phosphorylation. Biochem. J. 303: 701—704. PMID 7980435 DOI:10.1042/bj3030701
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Lau K.F., Miller C.C.J., Anderton B.H., Shaw P.C. (1999). Molecular cloning and characterization of the human glycogen synthase kinase-3beta promoter. Genomics. 60: 121—128. PMID 10486203 DOI:10.1006/geno.1999.5875
  • Rhoads A.R., Karkera J.D., Detera-Wadleigh S.D. (1999). Radiation hybrid mapping of genes in the lithium-sensitive wnt signaling pathway. Mol. Psychiatry. 4: 437—442. PMID 10523816 DOI:10.1038/sj.mp.4000538
  • Welsh G.I., Proud C.G. (1993). Glycogen synthase kinase-3 is rapidly inactivated in response to insulin and phosphorylates eukaryotic initiation factor eIF-2B. Biochem. J. 294: 625—629. PMID 8397507 DOI:10.1042/bj2940625
  • Sutherland C., Leighton I.A., Cohen P. (1993). Inactivation of glycogen synthase kinase-3 beta by phosphorylation: new kinase connections in insulin and growth-factor signalling. Biochem. J. 296: 15—19. PMID 8250835 DOI:10.1042/bj2960015

Примітки

  1. ↑ Сполуки, які фізично взаємодіють з glycogen synthase kinase 3 beta переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:4617 (англ.) . Процитовано 30 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. ↑ UniProt, P49841 (англ.) . Архів оригіналу за 8 вересня 2017. Процитовано 30 серпня 2017.

Див. також

  • Хромосома 3
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»