LYN

LYN
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1W1F, 1WA7, 3A4O

Ідентифікатори
Символи LYN, LYN proto-oncogene, Src family tyrosine kinase, JTK8, p53Lyn, p56Lyn
Зовнішні ІД OMIM: 165120 MGI: 96892 HomoloGene: 55649 GeneCards: LYN
Реагує на сполуку
bafetinib, бозутиніб, SU6656[1]
Онтологія гена
Молекулярна функція

transmembrane transporter binding
SH3 domain binding
GO:0032403 protein-containing complex binding
kinase activity
gamma-tubulin binding
signaling receptor binding
ATP binding
protein kinase activity
non-membrane spanning protein tyrosine kinase activity
enzyme binding
transferase activity
platelet-derived growth factor receptor binding
integrin binding
GO:0001948, GO:0016582 protein binding
glycosphingolipid binding
protein tyrosine kinase activity
nucleotide binding
phosphoprotein binding
ubiquitin protein ligase binding
ephrin receptor binding
phosphorylation-dependent protein binding

Клітинна компонента

цитоплазма
гіалоплазма
мембрана
extrinsic component of cytoplasmic side of plasma membrane
мітохондріальний міжмембранний простір
perinuclear region of cytoplasm
клітинне ядро
мітохондріальна мембрана
membrane raft
екзосома
комплекс Ґольджі
клітинна мембрана
GO:0097483, GO:0097481 постсинаптичне ущільнення
mast cell granule
integrin alpha2-beta1 complex
Криста
внутрішньоклітинна мембранна органела
glutamatergic synapse
postsynaptic specialization, intracellular component

Біологічний процес

regulation of protein phosphorylation
cellular response to extracellular stimulus
cellular response to retinoic acid
positive regulation of B cell receptor signaling pathway
tolerance induction to self antigen
regulation of mast cell activation
regulation of cell adhesion mediated by integrin
cellular response to heat
response to amino acid
кровотворення
адаптивна імунна відповідь
regulation of erythrocyte differentiation
cellular response to DNA damage stimulus
positive regulation of Fc receptor mediated stimulatory signaling pathway
platelet activation
Fc-epsilon receptor signaling pathway
protein phosphorylation
regulation of B cell apoptotic process
positive regulation of dendritic cell apoptotic process
positive regulation of glial cell proliferation
response to carbohydrate
regulation of platelet aggregation
negative regulation of cell population proliferation
B cell receptor signaling pathway
negative regulation of myeloid leukocyte differentiation
dendritic cell differentiation
Fc receptor mediated inhibitory signaling pathway
Fc-gamma receptor signaling pathway involved in phagocytosis
transmembrane receptor protein tyrosine kinase signaling pathway
regulation of B cell receptor signaling pathway
stimulatory C-type lectin receptor signaling pathway
response to sterol depletion
positive regulation of stress-activated protein kinase signaling cascade
GO:0032657 regulation of cytokine production
response to insulin
positive regulation of mast cell proliferation
negative regulation of MAP kinase activity
regulation of ERK1 and ERK2 cascade
positive regulation of peptidyl-tyrosine phosphorylation
erythrocyte differentiation
protein autophosphorylation
oligodendrocyte development
regulation of mast cell degranulation
positive regulation of phosphorylation
GO:0022415 viral process
response to toxic substance
GO:0033128 negative regulation of protein phosphorylation
Fc receptor mediated stimulatory signaling pathway
growth hormone receptor signaling pathway via JAK-STAT
фосфорилювання
процес імунної системи
regulation of release of sequestered calcium ion into cytosol
positive regulation of tyrosine phosphorylation of STAT protein
B cell homeostasis
immune response-regulating cell surface receptor signaling pathway
response to axon injury
negative regulation of mast cell proliferation
regulation of inflammatory response
peptidyl-tyrosine autophosphorylation
response to hormone
regulation of monocyte chemotaxis
leukocyte migration
lipopolysaccharide-mediated signaling pathway
histamine secretion by mast cell
GO:0007243 intracellular signal transduction
GO:1904578 response to organic cyclic compound
negative regulation of intracellular signal transduction
positive regulation of cell migration
ephrin receptor signaling pathway
negative regulation of toll-like receptor 2 signaling pathway
T cell costimulation
response to peptide hormone
platelet degranulation
зсідання крові
positive regulation of phosphatidylinositol 3-kinase activity
positive regulation of oligodendrocyte progenitor proliferation
negative regulation of immune response
positive regulation of cell population proliferation
positive regulation of neuron projection development
negative regulation of ERK1 and ERK2 cascade
peptidyl-tyrosine phosphorylation
negative regulation of B cell proliferation
negative regulation of toll-like receptor 4 signaling pathway
GO:0072468 сигнальна трансдукція
вроджений імунітет
neuron projection development
central nervous system development
inflammatory response
positive regulation of protein phosphorylation
positive regulation of phosphatidylinositol 3-kinase signaling
диференціація клітин
positive regulation of Ras protein signal transduction
positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process

Джерела:Amigo / QuickGO
Ортологи
Види Людина Миша
Entrez
4067
17096
Ensembl
ENSG00000254087
ENSMUSG00000042228
UniProt
P07948
P25911
RefSeq (мРНК)
NM_001111097
NM_002350
NM_001111096
NM_010747
RefSeq (білок)
NP_001104567
NP_002341
NP_001104566
NP_034877
Локус (UCSC) Хр. 8: 55.88 – 56.01 Mb Хр. 4: 3.68 – 3.81 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LYN (англ. LYN proto-oncogene, Src family tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 512 амінокислот, а молекулярна маса — 58 574[5].

Послідовність амінокислот
1020304050
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQL
LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWW
KAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSA
GAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRIT
FPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLV
KRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAR
EGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNA
DVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDF
YTATEGQYQQQP

Кодований геном білок за функціями належить до тирозинових протеїнкіназ родини Src-протеїнкіназ. Задіяний у таких біологічних процесах, як адаптивний імунітет, вроджений імунітет, взаємодія хазяїн-вірус, запальна відповідь. Білок має сайт для зв'язування з АТФ. Локалізований у клітинній мембрані, цитоплазмі, ядрі, апараті гольджі.

Література

  • Rider L.G., Raben N., Miller L., Jelsema C. (1994). The cDNAs encoding two forms of the LYN protein tyrosine kinase are expressed in rat mast cells and human myeloid cells. Gene. 138: 219—222. PMID 8125304 DOI:10.1016/0378-1119(94)90811-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Partanen J., Maekelae T.P., Alitalo R., Lehvaeslaiho H., Alitalo K. (1990). Putative tyrosine kinases expressed in K-562 human leukemia cells. Proc. Natl. Acad. Sci. U.S.A. 87: 8913—8917. PMID 2247464 DOI:10.1073/pnas.87.22.8913
  • Bielke W., Ziemiecki A., Kappos L., Miescher G.C. (1992). Expression of the B cell-associated tyrosine kinase gene Lyn in primary neuroblastoma tumours and its modulation during the differentiation of neuroblastoma cell lines. Biochem. Biophys. Res. Commun. 186: 1403—1409. PMID 1510669 DOI:10.1016/S0006-291X(05)81562-1
  • Roifman C.M., Ke S. (1993). CD19 is a substrate of the antigen receptor-associated protein tyrosine kinase in human B cells. Biochem. Biophys. Res. Commun. 194: 222—225. PMID 7687428 DOI:10.1006/bbrc.1993.1807
  • Wang A.V., Scholl P.R., Geha R.S. (1994). Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn. J. Exp. Med. 180: 1165—1170. PMID 8064233 DOI:10.1084/jem.180.3.1165

Примітки

  1. Сполуки, які фізично взаємодіють з LYN переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:6735 (англ.) . Процитовано 7 вересня 2017.
  5. UniProt, P07948 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 7 вересня 2017.

Див. також

  • Хромосома 8
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»