WNT3A

WNT3A
Ідентифікатори
Символи WNT3A, Wnt family member 3A
Зовнішні ІД OMIM: 606359 MGI: 98956 HomoloGene: 22528 GeneCards: WNT3A
Онтологія гена
Молекулярна функція

protein domain specific binding
signaling receptor binding
co-receptor binding
GO:0005110 frizzled binding
GO:0001948, GO:0016582 protein binding
GO:0001105 transcription coactivator activity
receptor ligand activity

Клітинна компонента

endocytic vesicle membrane
endoplasmic reticulum lumen
extracellular region
cell surface
екзосома
Wnt-Frizzled-LRP5/6 complex
early endosome membrane
клітинна мембрана
Golgi lumen
presynapse
міжклітинний простір
синапс
glutamatergic synapse

Біологічний процес

somitogenesis
cellular response to retinoic acid
кровотворення
positive regulation of protein phosphorylation
Wnt signaling pathway involved in forebrain neuroblast division
positive regulation of skeletal muscle tissue development
positive regulation of receptor internalization
axis elongation involved in somitogenesis
positive regulation of collateral sprouting in absence of injury
mammary gland development
platelet activation
heart looping
positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
positive regulation of protein localization to plasma membrane
cardiac muscle cell fate commitment
mesoderm development
cell proliferation in forebrain
positive regulation of mesodermal cell fate specification
negative regulation of fat cell differentiation
canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment
regulation of microtubule cytoskeleton organization
negative regulation of dopaminergic neuron differentiation
cell proliferation in midbrain
in utero embryonic development
negative regulation of axon extension involved in axon guidance
positive regulation of peptidyl-serine phosphorylation
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
regulation of axonogenesis
positive regulation of B cell proliferation
post-anal tail morphogenesis
positive regulation of cardiac muscle cell differentiation
negative regulation of neuron projection development
paraxial mesodermal cell fate commitment
negative regulation of neurogenesis
positive regulation of protein tyrosine kinase activity
positive regulation of DNA-binding transcription factor activity
extracellular matrix organization
positive regulation of neural precursor cell proliferation
synaptic vesicle recycling
osteoblast differentiation
skeletal muscle cell differentiation
COP9 signalosome assembly
dorsal/ventral neural tube patterning
positive regulation of protein binding
platelet aggregation
midbrain development
positive regulation of protein kinase activity
positive regulation of cell-cell adhesion mediated by cadherin
positive regulation of hepatocyte proliferation
Нейрогенез
spinal cord association neuron differentiation
аксоноґенеза
GO:0032737 positive regulation of cytokine production
positive regulation of dermatome development
somatic stem cell division
positive regulation of canonical Wnt signaling pathway involved in controlling type B pancreatic cell proliferation
axon guidance
multicellular organism development
determination of left/right symmetry
inner ear morphogenesis
positive regulation of cell population proliferation
регуляція диференціювання клітин
hippocampus development
negative regulation of heart induction by canonical Wnt signaling pathway
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
anterior/posterior pattern specification
Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation
beta-catenin destruction complex disassembly
neuron differentiation
Wnt signaling pathway
positive regulation of canonical Wnt signaling pathway
GO:1901313 positive regulation of gene expression
calcium ion transmembrane transport via low voltage-gated calcium channel
presynapse assembly
negative regulation of neuron death
positive regulation of core promoter binding
regulation of RNA biosynthetic process
regulation of signaling receptor activity
проліферація
canonical Wnt signaling pathway
secondary palate development
cell fate commitment
modulation of chemical synaptic transmission
GO:1904739 regulation of synapse organization
postsynapse to nucleus signaling pathway
regulation of presynapse assembly

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
89780
22416
Ensembl
ENSG00000154342
ENSMUSG00000009900
UniProt
P56704
P27467
RefSeq (мРНК)
NM_033131
NM_009522
RefSeq (білок)
NP_149122
NP_033548
Локус (UCSC) Хр. 1: 228.01 – 228.06 Mb Хр. 11: 59.14 – 59.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

WNT3A (англ. Wnt family member 3A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 352 амінокислот, а молекулярна маса — 39 365[4].

Послідовність амінокислот
1020304050
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP
KQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGP
VLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGW
KWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMH
LKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESR
GWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT
CK

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах як сигнальний шлях Wnt, альтернативний сплайсинг. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • Saitoh T., Hirai M., Katoh M. (2001). Molecular cloning and characterization of WNT3a and WNT14 clustered in human chromosome 1q42 region. Biochem. Biophys. Res. Commun. 284: 1168—1175. PMID 11414706 DOI:10.1006/bbrc.2001.5105
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Gao X., Hannoush R.N. (2014). Single-cell imaging of Wnt palmitoylation by the acyltransferase porcupine. Nat. Chem. Biol. 10: 61—68. PMID 24292069 DOI:10.1038/nchembio.1392
  • Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L. (1994). Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue. Cancer Res. 54: 2615—2621. PMID 8168088

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:15983 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P56704 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 28 серпня 2017.

Див. також

  • Хромосома 1
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.