ICAM1

ICAM1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1D3E, 1D3I, 1D3L, 1IAM, 1IC1, 1MQ8, 1P53, 1Z7Z, 2OZ4, 3TCX

Ідентифікатори
Символи ICAM1, BB2, CD54, P3.58, intercellular adhesion molecule 1
Зовнішні ІД OMIM: 147840 MGI: 96392 HomoloGene: 168 GeneCards: ICAM1
Онтологія гена
Молекулярна функція

virus receptor activity
GO:0032403 protein-containing complex binding
integrin binding
GO:0001948, GO:0016582 protein binding
transmembrane signaling receptor activity
signaling receptor activity

Клітинна компонента

integral component of membrane
мембрана
focal adhesion
клітинна мембрана
integral component of plasma membrane
cell surface
immunological synapse
membrane raft
екзосома
external side of plasma membrane
міжклітинний простір
GO:0005578 Позаклітинна матриця
collagen-containing extracellular matrix

Біологічний процес

leukocyte cell-cell adhesion
response to ionizing radiation
establishment of endothelial barrier
negative regulation of endothelial cell apoptotic process
cellular response to organic substance
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
response to amino acid
response to hypoxia
positive regulation of actin filament polymerization
GO:1904578 response to organic cyclic compound
T cell antigen processing and presentation
establishment of Sertoli cell barrier
response to sulfur dioxide
response to copper ion
interferon-gamma-mediated signaling pathway
positive regulation of nitric oxide biosynthetic process
response to amphetamine
cellular response to tumor necrosis factor
regulation of leukocyte mediated cytotoxicity
T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
extracellular matrix organization
acute inflammatory response to antigenic stimulus
слух
cellular response to alkaloid
response to gonadotropin
positive regulation of cellular extravasation
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
response to lipopolysaccharide
regulation of cell adhesion
адгезія клітин
cell adhesion mediated by integrin
positive regulation of NF-kappaB transcription factor activity
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
positive regulation of vasoconstriction
cellular response to interleukin-1
cellular response to nutrient levels
negative regulation of calcium ion transport
regulation of cell shape
membrane to membrane docking
positive regulation of peptidyl-tyrosine phosphorylation
ovarian follicle development
regulation of immune response
positive regulation of ERK1 and ERK2 cascade
regulation of ruffle assembly
viral entry into host cell
response to ethanol
GO:0022415 viral process
cellular response to lipopolysaccharide
cellular response to hypoxia
leukocyte migration
cellular response to glucose stimulus
response to insulin
cellular response to interferon-gamma
cellular response to interleukin-6
cellular response to dexamethasone stimulus
establishment of endothelial intestinal barrier
positive regulation of leukocyte adhesion to vascular endothelial cell
cellular response to leukemia inhibitory factor
cell-cell adhesion
cytokine-mediated signaling pathway
T cell extravasation
cellular response to amyloid-beta

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
3383
15894
Ensembl
ENSG00000090339
ENSMUSG00000037405
UniProt
P05362
P13597
RefSeq (мРНК)
NM_000201
NM_010493
RefSeq (білок)
NP_000192
NP_034623
Локус (UCSC) Хр. 19: 10.27 – 10.29 Mb Хр. 9: 20.93 – 20.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ICAM1 (англ. Intercellular adhesion molecule 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 532 амінокислот, а молекулярна маса — 57 825[4].

Послідовність амінокислот
1020304050
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCST
SCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
STAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVL
LRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELF
ENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQV
HLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL
GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDE
RDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRD
LEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLST
YLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу вірусу, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, взаємодія хазяїн-вірус. Локалізований у мембрані.

Література

  • Simmons D., Makgoba M.W., Seed B. (1988). ICAM, an adhesion ligand of LFA-1, is homologous to the neural cell adhesion molecule NCAM. Nature. 331: 624—627. PMID 3340213 DOI:10.1038/331624a0
  • Staunton D.E., Marlin S.D., Stratowa C., Dustin M.L., Springer T.A. (1988). Primary structure of ICAM-1 demonstrates interaction between members of the immunoglobulin and integrin supergene families. Cell. 52: 925—933. PMID 3349522 DOI:10.1016/0092-8674(88)90434-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Walter N.A.R., Stebbing J., Messier W. (2005). The potential significance of adaptive evolution and dimerization in chimpanzee intercellular cell adhesion molecules (ICAMs). J. Theor. Biol. 232: 339—346. PMID 15572059 DOI:10.1016/j.jtbi.2004.08.024
  • Coscoy L., Ganem D. (2001). A viral protein that selectively downregulates ICAM-1 and B7-2 and modulates T cell costimulation. J. Clin. Invest. 107: 1599—1606. PMID 11413168 DOI:10.1172/JCI12432
  • Hoer S., Smith L., Lehner P.J. (2007). MARCH-IX mediates ubiquitination and downregulation of ICAM-1. FEBS Lett. 581: 45—51. PMID 17174307 DOI:10.1016/j.febslet.2006.11.075

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:5344 (англ.) . Процитовано 12 вересня 2017.
  4. UniProt, P05362 (англ.) . Архів оригіналу за 2 жовтня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 19
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

  • п
  • о
  • р
Білки: кластери диференціації
1-5051-100101-150151-200201-250251-300301-350